Human MUC2 protein

Cannot supply to this region.

SKU:: ORB358107
Additional Names:: Intestinal mucin 2 protein, Intestinal mucin-2 protein, MLP protein, MUC 2 protein, MUC-2 protein, Muc2 protein, MUC2_HUMAN protein, Mucin 2 protein, Mucin 2 intestinal protein, Mucin 2 intestinal/tracheal protein, Mucin 2 oligomeric mucus/gel forming protein, Mucin 2 precursor protein, Mucin 2 tracheal protein, Mucin like protein protein, Mucin-2 protein, Mucin2 protein, SMUC protein
Molecular Weight:: 38.8 kDa
Purity:: Greater than 90% as determined by SDS-PAGE.
Source:: E.coli
Research Area:: Signal Transduction
Storage Conditions:: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
Supplier:: Biorbyt
Buffer:: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Format:: Liquid or Lyophilized powder
Sequence:: VCSTWGNFHYKTFDGDVFRFPGLCDYNFASDCRGSYKEFAVHLKRGPGQAEAPAGVESILLTIKDDTIYLTRHLAVLNGAVVSTPHYSPGLLIEKSDAYTKVYSRAGLTLMWNREDALMLELDTKFRNHTCGLCGDYNGLQSYSEFLSDGVLFSPLEFGNMQKINQPDVVCEDPEEEVAPASCSEHRAECERLLTAEAFADCQDL