ORB326838
MEDAG Rabbit Polyclonal Antibody
Cannot supply to this region.
- SKU:
- ORB326838
- Additional Names:
- anti AWMS3 antibody, anti hAWMS3 antibody
- Application:
- WB
- Concentration:
- 0.5 mg/ml
- Molecular Weight:
- 33kDa
- Storage Conditions:
- Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
- Supplier:
- Biorbyt
- Host:
- Rabbit
- Reactivities:
- Human
- Buffer:
- Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
- Format:
- Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
- Sequence:
- Synthetic peptide located within the following region: MLFFINVQTKKDTSKERTYAFLVNTRHPKIRRQIEQGMDMVISSVIGESY
- Gene Details:
- NP_116238
- Shipping Conditions:
- Blue Ice