Bone Morphogenetic Protein 4, BMP4

Cannot supply to this region.

SKU:: ORB3148691
Additional Names:: Bone Morphogenetic Protein 4, BMP4, BMP-4, BMP2B, BMP-2B, ZYME, DVR4
Application:: WB
Molecular Weight:: 13 kDa
Purity:: >95%
Research Area:: Stem Cell & Developmental Biology; Musculoskeletal & Connective Tissue Research
Storage Conditions:: 4°C for short-term and -70°/80°C long-term
Supplier:: Biorbyt
Buffer:: 20mM histidine pH 5.5, 0.2M NaCl, 0.6M arginine
Format:: Liquid (Sterile-filtered)
Sequence:: SPKHHSQRARKKNKNCRRHSLYVDFSDVGWNDWIVAPPGYQAFYCHGDCPFPLADHLNSTNHAIVQTLVNSVNSSIPKACCVPTELSAISMLYLDEYDKVVLKNYQEMVVEGCGCR