Recombinant Chlorocebus sabaeus Claudin (CLDN6)-VLPs (Active)

Cannot supply to this region.

SKU:: ORB2666716
Molecular Weight:: 22.6 kDa
Purity:: The purity information is not available for VLPs proteins.
Source:: Mammalian cell
Research Area:: Cancer Biology
Storage Conditions:: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Supplier:: Biorbyt
Buffer:: Lyophilized from a 0.2 μm sterile filtered PBS, 6% Trehalose, pH 7.4.
Format:: Lyophilized powder
Sequence:: LVSCALPMWKVTAFIGNSIVVAQVVWEGLWMSCVVQSTGQMQCKVYDSLLALPQDLQAARALCVIALLVALFGLLVYLAGAKCTTCVEEKDSKARLVLTSGIVFVISGVLTLIPVCWTAHAIIRDFYNPLVAEAQKRELGASLYLGWAASGLLLLGGGLLCCTCPSGGSRGPSHYMARYSTSAPAISRGPSEYPTKNYV