Recombinant Human Hepatic sodium/bile acid cotransporter (SLC10A1)-VLPs

Cannot supply to this region.

SKU:: ORB2666641
Additional Names:: Cell growth-inhibiting gene 29 protein;Sodium/taurocholate cotransporting polypeptide;NTCP;Solute carrier family 10 member 1;SLC10A1
Molecular Weight:: 39.5 kDa
Purity:: The purity information is not available for VLPs proteins.
Source:: Mammalian cell
Research Area:: Gastroenterology & Hepatology
Storage Conditions:: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Supplier:: Biorbyt
Buffer:: Lyophilized from a 0.2 μm sterile filtered PBS, 6% Trehalose, pH 7.4.
Format:: Lyophilized powder
Sequence:: MEAHNASAPFNFTLPPNFGKRPTDLALSVILVFMLFFIMLSLGCTMEFSKIKAHLWKPKGLAIALVAQYGIMPLTAFVLGKVFRLKNIEALAILVCGCSPGGNLSNVFSLAMKGDMNLSIVMTTCSTFCALGMMPLLLYIYSRGIYDGDLKDKVPYKGIVISLVLVLIPCTIGIVLKSKRPQYMRYVIKGGMIIILLCSVAVTVLSAINVGKSIMFAMTPLLIATSSLMPFIGFLLGYVLSALFCLNGRCRRTVSMETGCQNVQLCSTILNVAFPPEVIGPLFFFPLLYMIFQLGEGLLLIAIFWCYEKFKTPKDKTKMIYTAATTEETIPGALGNGTYKGEDCSPCTA