ORB2659733
Recombinant Human Kidney-associated antigen 1(KAAG1) (Active)
Cannot supply to this region.
- SKU:
- ORB2659733
- Additional Names:
- RU2AS
- Molecular Weight:
- 10.3 kDa
- Purity:
- Greater than 90% as determined by SDS-PAGE.
- Source:
- Baculovirus
- Research Area:
- Immunology & Inflammation; Kidney & Urological Research
- Storage Conditions:
- The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
- Supplier:
- Biorbyt
- Buffer:
- Lyophilized from a 0.2 μm sterile filtered PBS, 6% Trehalose, pH 7.4
- Format:
- Lyophilized powder
- Sequence:
- MDDDAAPRVEGVPVAVHKHALHDGLRQVAGPGAAAAHLPRWPPPQLAASRREAPPLSQRPHRTQGAGSPPETNEKLTNPQVKEK
- Shipping Conditions:
- Blue Ice