Recombinant Human AP-2 complex subunit sigma (AP2S1)

Cannot supply to this region.

SKU:: ORB2659672
Additional Names:: Adaptor protein complex AP-2 subunit sigma;Adaptor-related protein complex 2 subunit sigma;Clathrin assembly protein 2 sigma small chain;Clathrin coat assembly protein AP17;Clathrin coat-associated protein AP17;HA2 17 kDa subunit;Plasma membrane adaptor AP-2 17 kDa protein;Sigma2-adaptin
Molecular Weight:: 23.9 kDa
Purity:: Greater than 90% as determined by SDS-PAGE.
Source:: E.coli
Research Area:: Signal Transduction
Storage Conditions:: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Supplier:: Biorbyt
Buffer:: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Format:: Liquid or Lyophilized powder
Sequence:: MIRFILIQNRAGKTRLAKWYMQFDDDEKQKLIEEVHAVVTVRDAKHTNFVEFRNFKIIYRRYAGLYFCICVDVNDNNLAYLEAIHNFVEVLNEYFHNVCELDLVFNFYKVYTVVDEMFLAGEIRETSQTKVLKQLLMLQSLE