Recombinant Human Glycodelin (PAEP)

Cannot supply to this region.

SKU:: ORB2659562
Additional Names:: GD;Placental protein 14;PP14;Pregnancy-associated endometrial alpha-2 globulin;PAEG;PEG;Progestagen-associated endometrial protein;Progesterone-associated endometrial protein;Zona-binding inhibitory factor-1;ZIF-1
Molecular Weight:: 24.8 kDa
Purity:: Greater than 95% as determined by SDS-PAGE.
Source:: E.coli
Research Area:: Disease Biomarkers
Storage Conditions:: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Supplier:: Biorbyt
Buffer:: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Format:: Liquid or Lyophilized powder
Sequence:: MDIPQTKQDLELPKLAGTWHSMAMATNNISLMATLKAPLRVHITSLLPTPEDNLEIVLHRWENNSCVEKKVLGEKTENPKKFKINYTVANEATLLDTDYDNFLFLCLQDTTTPIQSMMCQYLARVLVEDDEIMQGFIRAFRPLPRHLWYLLDLKQMEEPCRF