Recombinant Mouse Peroxiredoxin-6 (Prdx6)

Cannot supply to this region.

SKU:: ORB2659162
Additional Names:: 1-Cys peroxiredoxin;1-Cys PRX;Acidic calcium-independent phospholipase A2;aiPLA2;EC 3.1.1.4;Antioxidant protein 2;Glutathione-dependent peroxiredoxin;Lysophosphatidylcholine acyltransferase 5;LPC acyltransferase 5;LPCAT-5;Lyso-PC acyltransferase 5;EC 2.3.1.23;Non-selenium glutathione peroxidase;NSGPx
Molecular Weight:: 31.7 kDa
Purity:: Greater than 95% as determined by SDS-PAGE.
Source:: E.coli
Research Area:: Metabolism Research
Storage Conditions:: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Supplier:: Biorbyt
Buffer:: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Format:: Liquid or Lyophilized powder
Sequence:: PGGLLLGDEAPNFEANTTIGRIRFHDFLGDSWGILFSHPRDFTPVCTTELGRAAKLAPEFAKRNVKLIALSIDSVEDHLAWSKDINAYNGETPTEKLPFPIIDDKGRDLAILLGMLDPVEKDDNNMPVTARVVFIFGPDKKLKLSILYPATTGRNFDEILRVVDSLQLTGTKPVATPVDWKKGESVMVVPTLSEEEAKQCFPKGVFTKELPSGKKYLRYTPQP