ORB2658855
Recombinant Human Interleukin-15 receptor subunit alpha (IL15RA), partial (Active)
Cannot supply to this region.
- SKU:
- ORB2658855
- Additional Names:
- IL-15 receptor subunit alpha; IL-15R-alpha; IL-15RA
- Molecular Weight:
- 19.9 kDa
- Purity:
- Greater than 95% as determined by SDS-PAGE.
- Source:
- Mammalian cell
- Research Area:
- Immunology & Inflammation; Cell Biology
- Storage Conditions:
- The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
- Supplier:
- Biorbyt
- Buffer:
- Lyophilized from a 0.2 μm sterile filtered PBS, 6% Trehalose, pH 7.4
- Format:
- Lyophilized powder
- Sequence:
- ITCPPPMSVEHADIWVKSYSLYSRERYICNSGFKRKAGTSSLTECVLNKATNVAHWTTPSLKCIRDPALVHQRPAPPSTVTTAGVTPQPESLSPSGKEPAASSPSSNNTAATTAAIVPGSQLMPSKSPSTGTTEISSHESSHGTPSQTTAKNWELTASASHQPPGVYPQGHSDTT
- Shipping Conditions:
- Blue Ice