Recombinant Mycobacterium bovis Diacylglycerol acyltransferase/mycolyltransferase Ag85B (fbpB)

Cannot supply to this region.

SKU:: ORB2658761
Additional Names:: DGAT;30 kDa extracellular protein;Acyl-CoA:diacylglycerol acyltransferase;Antigen 85 complex B;85B;Ag85B;Extracellular alpha-antigen;Fibronectin-binding protein B;Fbps B
Molecular Weight:: 37.5 kDa
Purity:: Greater than 95% as determined by SDS-PAGE.
Source:: E.coli
Storage Conditions:: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Supplier:: Biorbyt
Buffer:: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Format:: Liquid or Lyophilized powder
Sequence:: FSRPGLPVEYLQVPSPSMGRDIKVQFQSGGNNSPAVYLLDGLRAQDDYNGWDINTPAFEWYYQSGLSIVMPVGGQSSFYSDWYSPACGKAGCQTYKWETLLTSELPQWLSANRAVKPTGSAAIGLSMAGSSAMILAAYHPQQFIYAGSLSALLDPSQGMGPSLIGLAMGDAGGYKAADMWGPSSDPAWERNDPTQQIPKLVANNTRLWVYCGNGTPNELGGANIPAEFLENFVRSSNLKFQDAYNAAGGHNAVFNFPPNGTHSWEYWGAQLNAMKGDLQSSLGAG