Recombinant Bovine Fibroblast growth factor 2 (FGF2) (Active)

Cannot supply to this region.

SKU:: ORB2658712
Additional Names:: Fibroblast growth factor 2; FGF-2; Basic fibroblast growth factor (bFGF); Heparin-binding growth factor 2 (HBGF-2); Kidney-derived growth factor; FGF2
Molecular Weight:: 16.5 kDa
Purity:: Greater than 95% as determined by SDS-PAGE.
Source:: E.coli
Research Area:: Cardiovascular Research; Stem Cell & Developmental Biology
Storage Conditions:: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Supplier:: Biorbyt
Buffer:: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Format:: Lyophilized powder
Sequence:: PALPEDGGSGAFPPGHFKDPKRLYCKNGGFFLRIHPDGRVDGVREKSDPHIKLQLQAEERGVVSIKGVCANRYLAMKEDGRLLASKCVTDECFFFERLESNNYNTYRSRKYSSWYVALKRTGQYKLGPKTGPGQKAILFLPMSAKS