ORB2658706
Recombinant Human B-cell antigen receptor complex-associated protein alpha chain (CD79A), partial (Active)
Cannot supply to this region.
- SKU:
- ORB2658706
- Additional Names:
- B-cell antigen receptor complex-associated protein alpha chain; Ig-alpha;MB-1 membrane glycoprotein; Membrane-bound immunoglobulin-associated protein; Surface IgM-associated protein; CD79a
- Molecular Weight:
- 14.0 kDa
- Purity:
- Greater than 90% as determined by SDS-PAGE.
- Source:
- Mammalian cell
- Research Area:
- Immunology & Inflammation
- Storage Conditions:
- The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
- Supplier:
- Biorbyt
- Buffer:
- Lyophilized from a 0.2 μm sterile filtered PBS, 6% Trehalose, pH 7.4
- Format:
- Lyophilized powder
- Sequence:
- LWMHKVPASLMVSLGEDAHFQCPHNSSNNANVTWWRVLHGNYTWPPEFLGPGEDPNGTLIIQNVNKSHGGIYVCRVQEGNESYQQSCGTYLRVRQPPPRPFLDMGEGTKNR
- Shipping Conditions:
- Blue Ice