ORB2657943
Recombinant Human Platelet-derived growth factor subunit B (PDGFB) (Active)
Cannot supply to this region.
- SKU:
- ORB2657943
- Additional Names:
- PDGFBB; PDGF-BB
- Molecular Weight:
- 12.2 kDa
- Purity:
- Greater than 95% as determined by SDS-PAGE.
- Source:
- Yeast
- Research Area:
- Stem Cell & Developmental Biology
- Storage Conditions:
- The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
- Supplier:
- Biorbyt
- Buffer:
- Lyophilized from a 0.2 μm filtered solution containing 100mM Citratesodium citrate, 5% Mannitol 0.1% Trehalose pH 6.5
- Format:
- Lyophilized powder
- Sequence:
- SLGSLTIAEPAMIAECKTRTEVFEISRRLIDRTNANFLVWPPCVEVQRCSGCCNNRNVQCRPTQVQLRPVQVRKIEIVRKKPIFKKATVTLEDHLACKCETVAAARPVT
- Shipping Conditions:
- Blue Ice