ORB2657940
Recombinant Human Transforming growth factor beta-1 proprotein (TGFB1), partial (Active)
Cannot supply to this region.
- SKU:
- ORB2657940
- Additional Names:
- Transforming Growth Factor Beta-1; TGF-Beta-1; Latency-Associated Peptide; LAP; TGFB1; TGFB
- Molecular Weight:
- 12.8 kDa
- Purity:
- Greater than 95% as determined by SDS-PAGE.
- Source:
- Mammalian cell
- Research Area:
- Stem Cell & Developmental Biology
- Storage Conditions:
- The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
- Supplier:
- Biorbyt
- Buffer:
- Lyophilized from a 0.2 μm filtered solution containing 100 mM Glycine,5%mannitoland0.01% Tween 80, pH 7.4
- Format:
- Lyophilized powder
- Sequence:
- ALDTNYCFSSTEKNCCVRQLYIDFRKDLGWKWIHEPKGYHANFCLGPCPYIWSLDTQYSKVLALYNQHNPGASAAPCCVPQALEPLPIVYYVGRKPKVEQLSNMIVRSCKCS
- Shipping Conditions:
- Blue Ice