ORB2657938
Recombinant Human Insulin (INS), partial
Cannot supply to this region.
- SKU:
- ORB2657938
- Additional Names:
- Insulin; INS; IDDM; ILPR; IRDN; MODY10
- Molecular Weight:
- 5.8 kDa
- Purity:
- Greater than 95% as determined by SDS-PAGE.
- Source:
- Yeast
- Research Area:
- Metabolism Research
- Storage Conditions:
- The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
- Supplier:
- Biorbyt
- Buffer:
- Lyophilized from a 0.2 μm filtered solution(It is recommended to redissolve in sterile 0.01 M HCl at a concentration of not less than 1mg/mL.)
- Format:
- Lyophilized powder
- Sequence:
- GIVEQCCTSICSLYQLENYCN&FVNQHLCGSHLVEALYLVCGERGFFYTPKT
- Shipping Conditions:
- Blue Ice