ORB2657927
Recombinant Bovine Fibroblast growth factor 2 (FGF2) (Active)
Cannot supply to this region.
- SKU:
- ORB2657927
- Additional Names:
- Fibroblast Growth Factor 2; FGF-2; Basic Fibroblast Growth Factor; bFGF; Heparin-Binding Growth Factor 2; HBGF-2; FGF2; FGFB
- Molecular Weight:
- 16.5 kDa
- Purity:
- Greater than 95% as determined by SDS-PAGE.
- Source:
- E.coli
- Research Area:
- Cardiovascular Research; Stem Cell & Developmental Biology
- Storage Conditions:
- The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
- Supplier:
- Biorbyt
- Buffer:
- Lyophilized from a 0.2 μm filtered solution containing 10mMPB, 250mMNaCl,5%mannitol and 0.01% Tween 80 ,pH 7.4
- Format:
- Lyophilized powder
- Sequence:
- PALPEDGGSGAFPPGHFKDPKRLYCKNGGFFLRIHPDGRVDGVREKSDPHIKLQLQAEERGVVSIKGVCANRYLAMKEDGRLLASKCVTDECFFFERLESNNYNTYRSRKYSSWYVALKRTGQYKLGPKTGPGQKAILFLPMSAKS
- Shipping Conditions:
- Blue Ice