ORB2657924
Recombinant Human Vitronectin (VTN) (Active)

Cannot supply to this region.
- SKU:
- ORB2657924
- Additional Names:
- Vitronectin; VN; S-Protein; Serum-Spreading Factor; V75; VTN
- Molecular Weight:
- 52.3 kDa
- Purity:
- Greater than 95% as determined by SDS-PAGE.
- Source:
- Mammalian cell
- Storage Conditions:
- The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
- Supplier:
- Biorbyt
- Buffer:
- 0.2 μm-filtered solution containing PBS,5% mannitol and 0.01% Tween 80, pH 7.4
- Format:
- Liquid
- Sequence:
- DQESCKGRCTEGFNVDKKCQCDELCSYYQSCCTDYTAECKPQVTRGDVFTMPEDEYTVYDDGEEKNNATVHEQVGGPSLTSDLQAQSKGNPEQTPVLKPEEEAPAPEVGASKPEGIDSRPETLHPGRPQPPAEEELCSGKPFDAFTDLKNGSLFAFRGQYCYELDEKAVRPGYPKLIRDVWGIEGPIDAAFTRINCQGKTYLFKGSQYWRFEDGVLDPDYPRNISDGFDGIPDNVDAALALPAHSYSGRERVYFFKGKQYWEYQFQHQPSQEECEGSSLSAVFEHFAMMQRDSWEDIFELLFWGRTSAGTRQPQFISRDWHGVPGQVDAAMAGRIYISGMAPRPSLAKKQRFRHRNRKGYRSQRGHSRGRNQNSRRPSRATWLSLFSSEESNLGANNYDDYRMDWLVPATCEPIQSVFFFSGDKYYRVNLRTRRVDTVDPPYPRSIAQYWLGCPAPGHL
- Shipping Conditions:
- Blue Ice
