Recombinant Human Tissue factor (F3), partial

Cannot supply to this region.

SKU:: ORB2657910
Additional Names:: Tissue Factor; TF; Coagulation Factor III; Thromboplastin; CD142; F3
Molecular Weight:: 24.8 kDa
Purity:: Greater than 95% as determined by SDS-PAGE.
Source:: Mammalian cell
Storage Conditions:: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Supplier:: Biorbyt
Buffer:: Lyophilized from 0.22 μm filtered solution in PBS，5%mannital，0.01% Tween80 pH 7.4.
Format:: Lyophilized powder
Sequence:: SGTTNTVAAYNLTWKSTNFKTILEWEPKPVNQVYTVQISTKSGDWKSKCFYTTDTECDLTDEIVKDVKQTYLARVFSYPAGNVESTGSAGEPLYENSPEFTPYLETNLGQPTIQSFEQVGTKVNVTVEDERTLVRRNNTFLSLRDVFGKDLIYTLYYWKSSSSGKKTAKTNTNEFLIDVDKGENYCFSVQAVIPSRTVNRKSTDSPVECMGQEKGEFRE