Human FGF7 protein (Active)

Cannot supply to this region.

SKU:: ORB2657903
Additional Names:: Fibroblast growth factor 7; FGF-7; Heparin-binding growth factor 7; HBGF-7; Keratinocyte growth factor; FGF7; KGF
Molecular Weight:: 18.8 kDa
Purity:: Greater than 95% as determined by SDS-PAGE.
Source:: Mammalian cell
Storage Conditions:: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Supplier:: Biorbyt
Buffer:: Lyophilized from a 0.2 μm filtered solution containing PBS, 5% mannitoland 0.01% Tween 80, pH 7.4
Format:: Lyophilized powder
Sequence:: CNDMTPEQMATNVNCSSPERHTRSYDYMEGGDIRVRRLFCRTQWYLRIDKRGKVKGTQEMKNNYNIMEIRTVAVGIVAIKGVESEFYLAMNKEGKLYAKKECNEDCNFKELILENHYNTYASAKWTHNGGEMFVALNQKGIPVRGKKTKKEQKTAHFLPMAIT