Recombinant Human Transforming growth factor beta-2 proprotein (TGFB2), partial (Active)

Cannot supply to this region.

SKU:: ORB2657894
Additional Names:: Transforming growth factor beta-2; TGFB2; Polyergin; G-TSF; Glioblastoma-derived T-cell suppressor factor; Cetermin; BSC-1 cell growth inhibitor; TGF-beta-2
Molecular Weight:: 12.7 kDa
Purity:: Greater than 95% as determined by SDS-PAGE.
Source:: Mammalian cell
Research Area:: Stem Cell & Developmental Biology
Storage Conditions:: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Supplier:: Biorbyt
Buffer:: Lyophilized from a 0.2 μm filtered solution containing 0.085% TFA,5%mannitol and 30% ACN, pH 2.5
Format:: Lyophilized powder
Sequence:: ALDAAYCFRNVQDNCCLRPLYIDFKRDLGWKWIHEPKGYNANFCAGACPYLWSSDTQHSRVLSLYNTINPEASASPCCVSQDLEPLTILYYIGKTPKIEQLSNMIVKSCKCS