Recombinant Human R-spondin-1 (RSPO1) (Active)

Cannot supply to this region.

SKU:: ORB2657889
Additional Names:: RSPO1; R-spondin1; RP11-566C13.1; CRISTIN3; FLJ40906; RSPO Rspo1; R-spondin; Rspondin; RP23-325M14.2; Roof plate-specific spondin-1
Molecular Weight:: 26.7 kDa
Purity:: Greater than 95% as determined by SDS-PAGE.
Source:: Mammalian cell
Storage Conditions:: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Supplier:: Biorbyt
Buffer:: Lyophilized from a 0.2 μm filtered solution containing PBS, 5% mannitoland 0.01% Tween 80, pH 7.4
Format:: Lyophilized powder
Sequence:: SRGIKGKRQRRISAEGSQACAKGCELCSEVNGCLKCSPKLFILLERNDIRQVGVCLPSCPPGYFDARNPDMNKCIKCKIEHCEACFSHNFCTKCKEGLYLHKGRCYPACPEGSSAANGTMECSSPAQCEMSEWSPWGPCSKKQQLCGFRRGSEERTRRVLHAPVGDHAACSDTKETRRCTVRRVPCPEGQKRRKGGQGRRENANRNLARKESKEAGAGSRRRKGQQQQQQQGTVGPLTSAGPA