Aquaporin 4 Proteins

Cannot supply to this region.

SKU:: ORB246722
Additional Names:: Anti-AQP 4 antibody, anti-AQP-4 antibody, anti-AQP4 antibody, anti-Aquaporin type 4 antibody, anti-AQP4_HUMAN antibody, anti-Aquaporin-4 antibody, anti-Aquaporin4 antibody, anti-Aquaporin 4 antibody
Molecular Weight:: 10 kDa
Purity:: Greater than 90% as determined by SDS-PAGE.
Source:: Yeast
Research Area:: Kidney & Urological Research
Storage Conditions:: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
Supplier:: Biorbyt
Buffer:: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Format:: Liquid or Lyophilized powder
Sequence:: CPDVEFKRRFKEAFSKAAQQTKGSYMEVEDNRSQVETDDLILKPGVVHVIDVDRGEEKKGKDQSGEVLSSV