Human beta 1 Adrenergic Receptor protein

Cannot supply to this region.

SKU:: ORB246716
Additional Names:: ADR B1 protein, ADRB 1 protein, ADRB1 protein, ADRB1R protein, Adrenergic beta 1 receptor protein, Adrenoceptor beta 1 protein, B1AR protein, Beta 1 adrenoceptor protein, Beta 1 adrenoreceptor protein, Beta-1 adrenergic receptor protein, Beta-1 adrenoceptor protein, Beta-1 adrenoreceptor protein, BETA1AR protein, RHR protein
Molecular Weight:: 12.5 kDa
Purity:: Greater than 90% as determined by SDS-PAGE.
Source:: Yeast
Research Area:: Cardiovascular Research
Storage Conditions:: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
Supplier:: Biorbyt
Buffer:: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Format:: Liquid or Lyophilized powder
Sequence:: CRSPDFRKAFQRLLCCARRAARRRHATHGDRPRASGCLARPGPPPSPGAASDDDDDDVVGATPPARLLEPWAGCNGGAAADSDSSLDEPCRPGFASESKV