ORB246715
Yeast MDR1 protein

Cannot supply to this region.
- SKU:
- ORB246715
- Additional Names:
- ABC20 protein, ABCB1 protein, ABCB1B protein, CD243 protein, CLCS protein, GP170 protein, IBD13 protein, PGY1 protein, ATP-binding cassette sub-family B member 1 protein, ATP-binding cassette, sub-family B (MDR/TAP), member 1 protein, CD243 antigen protein, colchicin sensitivity protein, doxorubicin resistance protein, multidrug resistance protein 1 protein, P-glycoprotein 1 protein, P-gp protein, PGY1P-GP protein, ATP binding cassette, sub family B (MDR/TAP), member 1 protein, MDR1 protein, MDR 1 protein, Multidrug resistance 1 protein, P glycoprotein 1 protein, P gp protein
- Molecular Weight:
- 14.5 kDa
- Purity:
- Greater than 90% as determined by SDS-PAGE.
- Source:
- Yeast
- Research Area:
- Infectious Disease & Virology
- Storage Conditions:
- The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
- Supplier:
- Biorbyt
- Buffer:
- If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
- Format:
- Liquid or Lyophilized powder
- Sequence:
- SGCGKSTTIQLIQRNYEPNGGRVTLDGKDIRELNIKWLRNQIGLVGQEPVLFAGTIRENIMLGAKEGETLSKDEMIECAKMANAHEFVSKLAEGYDTLIGEKGALLSGGQRQRI
- Shipping Conditions:
- Blue Ice
