Rat S100A8 protein

Cannot supply to this region.

SKU:: ORB246432
Additional Names:: CAGA protein, Calgranulin-A protein, CFAG protein, CGLA protein, Chemotactic cytokine CP-10 protein, CP-10 protein, Cystic fibrosis antigen protein, L1Ag protein, Leukocyte L1 complex light chain protein, MA387 protein, Migration inhibitory factor-related protein 8 protein, Myeloid-related protein 8 protein, Neutrophil cytosolic 7 kDa protein protein, NIF protein, Pro-inflammatory S100 cytokine protein, Protein S100-A8 protein, S100 calcium binding protein A8 (calgranulin A) protein, S100 calcium binding protein A8 protein, S100A8 protein, S100A8/S100A9 complex, included protein, Urinary stone protein band A protein, MRP8 protein, MRP-8 protein, 60B8Ag protein
Molecular Weight:: 14.1 kDa
Purity:: Greater than 90% as determined by SDS-PAGE.
Source:: E.coli
Research Area:: Cell Biology
Storage Conditions:: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
Supplier:: Biorbyt
Buffer:: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Format:: Liquid or Lyophilized powder
Sequence:: ATELEKALSNVIEVYHNYSGIKGNHHALYRDDFRKMVTTECPQFVQNKNTESLFKELDVNSDNAINFEEFLVLVIRVGVAAHKDSHKE

Shipping Conditions:: Blue Ice