E.coli IL1 alpha protein

Cannot supply to this region.

SKU:: ORB246368
Additional Names:: Hematopoietin 1 protein, Hematopoietin-1 protein, IL 1 alpha protein, IL 1 protein, IL 1A protein, IL-1 alpha protein, Il-1a protein, IL1 ALPHA protein, IL1 protein, IL1A protein, IL1A_HUMAN protein, IL1F1 protein, ilia protein, Interleukin 1 alpha protein, Interleukin 1 alpha precursor protein, Interleukin-1 alpha protein, Interleukin1 alpha protein, Preinterleukin 1 alpha protein, Pro interleukin 1 alpha protein
Molecular Weight:: 34.1 kDa
Purity:: Greater than 90% as determined by SDS-PAGE.
Source:: E.coli
Research Area:: Infectious Disease & Virology; Immunology & Inflammation
Storage Conditions:: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
Supplier:: Biorbyt
Buffer:: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Format:: Liquid or Lyophilized powder
Sequence:: SAPFSFLSNMTYHFIRIIKHEFILNDTLNQTIIRANDQHLTAAAIHNLDEAVKFDMGAYTSSKDDTKVPVILRISKTQLYVSAQDEDQPVLLKEMPEINKTITGSETNFLFFWETHGTKNYFISVAHPNLFIATKHDNWVCLAKGLPSITDFQILENQA