Human CD41 protein

Cannot supply to this region.

SKU:: ORB246226
Additional Names:: Antigen CD41 protein, CD 41 protein, CD41 protein, CD-41 protein, CD41 antigen protein, CD41a protein, CD41b protein, GP2b protein, GPalpha IIb protein, GPalphaIIb protein, GPIIb protein, GT protein, Gta protein, HPA 3 protein, HPA3 protein, Integrin alpha 2b protein, Integrin alpha IIb protein, Integrin alpha IIb precursor protein, Integrin alpha-IIb light chain protein, ITGA 2B protein, ITGA2B protein, ITGAB protein, Platelet membrane glycoprotein IIb protein, Platelet specific antigen bak protein
Molecular Weight:: 43 kDa
Purity:: Greater than 90% as determined by SDS-PAGE.
Source:: E.coli
Research Area:: Immunology & Inflammation
Storage Conditions:: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
Supplier:: Biorbyt
Buffer:: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Format:: Liquid or Lyophilized powder
Sequence:: CVPQLQLTASVTGSPLLVGADNVLELQMDAANEGEGAYEAELAVHLPQGAHYMRALSNVEGFERLICNQKKENETRVVLCELGNPMKKNAQIGIAMLVSVGNLEEAGESVSFQLQIRSKNSQNPNSKIVLLDVPVRAEAQVELRGNSFPASLVVAAEEGEREQNSLDSWGPKVEHTYELHNNGPGTVNGLHLSIHLPGQSQPSDLLYILDIQPQGGLQCFPQPPVNPLKVDWGLPIPSPSPIHPAHHKR

Shipping Conditions:: Blue Ice