ORB245660
Rat TIMP1 protein
Cannot supply to this region.
- SKU:
- ORB245660
- Additional Names:
- Clgi protein, Collagenase inhibitor protein, Collagenase inhibitor, Human protein, EPA protein, Erythroid Potentiating Activity protein, Erythroid-potentiating activity protein, Fibroblast collagenase inhibitor protein, HCI protein, Human Collagenase Inhibitor protein, Metalloproteinase inhibitor 1 protein, Metalloproteinase inhibitor 1 precursor protein, TIMP 1 protein, TIMP protein, TIMP metallopeptidase inhibitor 1 protein, TIMP-1 protein, Timp1 protein, TIMP1 protein protein, Tissue Inhibitor of Metalloproteinase 1 protein, Tissue inhibitor of metalloproteinases 1 protein, Tissue inhibitor of metalloproteinases protein
- Molecular Weight:
- 25.5 kDa
- Purity:
- Greater than 90% as determined by SDS-PAGE.
- Source:
- E.coli
- Research Area:
- Cancer Biology
- Storage Conditions:
- The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
- Supplier:
- Biorbyt
- Buffer:
- If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
- Format:
- Liquid or Lyophilized powder
- Sequence:
- CSCAPTHPQTAFCNSDLVIRAKFMGSPEIIETTLYQRYEIKMTKMLKGFDAVGNATGFRFAYTPAMESLCGYVHKSQNRSEEFLIAGRLRNGNLHITACSFLVPWHNLSPAQQKAFVKTYSAGCGVCTVFPCSAIPCKLESDSHCLWTDQILMGSEKGYQSDHFACLPRNPDLCTWQYLGVSMTRSLPLAKAEA
- Shipping Conditions:
- Blue Ice