ORB245650
Rat eNOS protein
Cannot supply to this region.
- SKU:
- ORB245650
- Additional Names:
- cNOS protein, Constitutive NOS protein, EC NOS protein, EC-NOS protein, ecNOS protein, Endothelial nitric oxidase synthase protein, Endothelial nitric oxide synthase protein, Endothelial nitric oxide synthase 3 protein, Endothelial NOS protein, eNOS protein, Nitric oxide synthase 3 (endothelial cell) protein, Nitric oxide synthase 3 protein, Nitric oxide synthase 3 endothelial cell protein, Nitric oxide synthase endothelial protein, Nitric oxide synthase, endothelial protein, NOS 3 protein, NOS III protein, NOS type III protein, NOS3 protein, NOS3_HUMAN protein, NOSIII protein
- Molecular Weight:
- 22.9 kDa
- Purity:
- Greater than 90% as determined by SDS-PAGE.
- Source:
- E.coli
- Research Area:
- Epigenetics
- Storage Conditions:
- The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
- Supplier:
- Biorbyt
- Buffer:
- If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
- Format:
- Liquid or Lyophilized powder
- Sequence:
- ATILYGSETGRAQSYAQQLGRLFRKAFDPRVLCMDEYDVVSLEHEALVLVVTSTFGNGDPPENGESFAAALMEMSGPYNSSPRPEQHKSYKIRFNSVSCSDPLVSSWRRKRKESSNTDSAGALGTLRFCVFGLGSRAYPHFCAFARAVDTRLEELGGERLLQLGQGDELCGQ
- Shipping Conditions:
- Blue Ice