Human CD147 protein

Cannot supply to this region.

SKU:: ORB245520
Additional Names:: 5A11 antigen protein, 5F7 protein, BASI_HUMAN protein, Basigin (Ok blood group) protein, Basigin protein, Blood brain barrier HT7 antigen protein, BSG protein, CD 147 protein, CD147 protein, CD147 antigen protein, Collagenase stimulatory factor protein, Emmprin protein, Extracellular matrix metalloproteinase inducer protein, Leukocyte activation antigen M6 protein, M 6 protein, M6 protein, M6 antigen protein, M6 leukocyte activation antigen protein, Neurothelin protein, OK protein, OK blood group protein, OK blood group antigen protein, TCSF protein, Tumor cell derived collagenase stimulatory factor protein, Tumor cell-derived collagenase stimulatory factor protein
Molecular Weight:: 24.2 kDa
Purity:: Greater than 90% as determined by SDS-PAGE.
Source:: E.coli
Research Area:: Immunology & Inflammation; Cell Biology
Storage Conditions:: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
Supplier:: Biorbyt
Buffer:: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Format:: Liquid or Lyophilized powder
Sequence:: EPGTVFTTVEDLGSKILLTCSLNDSATEVTGHRWLKGGVVLKEDALPGQKTEFKVDSDDQWGEYSCVFLPEPMGTANIQLHGPPRVKAVKSSEHINEGETAMLVCKSESVPPVTDWAWYKITDSEDKALMNGSESRFFVSSSQGRSELHIENLNMEADPGQYRCNGTSSKGSDQAIITLRVRSH

Shipping Conditions:: Blue Ice