Human CD24 protein

Cannot supply to this region.

SKU:: ORB245463
Additional Names:: CD 24 protein, CD24 protein, CD-24 protein , CD24 antigen protein, CD24 molecule protein, CD24A protein, GPI linked surface mucin protein, GPI linked surface mucin protein, Heat stable antigen protein, HSA protein, Nectadrin protein, Signal transducer CD24 protein
Molecular Weight:: 32.3 kDa
Purity:: Greater than 90% as determined by SDS-PAGE.
Source:: E.coli
Research Area:: Immunology & Inflammation
Storage Conditions:: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
Supplier:: Biorbyt
Buffer:: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Format:: Liquid or Lyophilized powder
Sequence:: SETTTGTSSNSSQSTSNTGLAPNPTNATTKAAGGALQSTASLFVVSLSLLHLYS