ORB245423
Mouse CXCL14 protein
Cannot supply to this region.
- SKU:
- ORB245423
- Additional Names:
- C-X-C motif chemokine 14 protein, Chaemokine, CXC motif, ligand 14 protein, Chemokine (C-X-C motif) ligand 14 protein, Chemokine BRAK protein, CXC chemokine in breast and kidney protein, CXCL 14 protein, CXCL-14 protein, CXCL14 protein, CXL14_HUMAN protein, JSC protein, Kec protein, Kidney-expressed chemokine CXC protein, KS1 protein, MGC10687 protein, MGC124510 protein, MGC90667 protein, 1110031L23Rik protein, 1200006I23Rik protein, AI414372 protein, BMAC protein, bolekine protein, MIP 2 gamma protein, MIP-2G protein, MIP2G protein, MIP2gamma protein, NJAC protein, PRO273 protein, PSEC0212 protein, Scyb14 protein, Small Inducible Cytokine B14 protein, Small inducible cytokine subfamily B (Cys-X-Cys) member 14 (BRAK) protein, Small Inducible Cytokine subfamily B, member 14 protein, Small-inducible cytokine B14 protein, UNQ240 protein, CXC-X3 protein, BRAKKEC protein, member 14 (BRAK) protein, MIP-2 gamma protein, NJACKec protein, SCYB14MGC10687 protein
- Molecular Weight:
- 13.4 kDa
- Purity:
- Greater than 90% as determined by SDS-PAGE.
- Source:
- E.coli
- Research Area:
- Immunology & Inflammation
- Storage Conditions:
- The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
- Supplier:
- Biorbyt
- Buffer:
- If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
- Format:
- Liquid or Lyophilized powder
- Sequence:
- SKCKCSRKGPKIRYSDVKKLEMKPKYPHCEEKMVIVTTKSMSRYRGQEHCLHPKLQSTKRFIKWYNAWNEKRRVYEE
- Shipping Conditions:
- Blue Ice