Human TNFR1 protein

Cannot supply to this region.

SKU:: ORB245321
Additional Names:: CD120a Protein, FPF Protein, MGC19588 Protein, p55 Protein, p55-R Protein, p60 Protein, TBP1 Protein, TBPI Protein, TNF R Protein, TNF R55 Protein, TNF-R1 Protein, TNF-RI Protein, TNFAR Protein, TNFR-I Protein, TNFR1 Protein, TNFR55 Protein, TNFR60 Protein, TNFRI Protein, TNFRSF1a Protein, TNR1A_HUMAN Protein, Tumor necrosis factor receptor 1 Protein, Tumor necrosis factor receptor superfamily, member 1A Protein, Tumor necrosis factor receptor type 1 Protein, Tumor necrosis factor receptor type I Protein, Tumor necrosis factor-binding protein 1 Protein
Molecular Weight:: 47.2 kDa
Purity:: Greater than 90% as determined by SDS-PAGE.
Source:: E.coli
Research Area:: Cell Biology
Storage Conditions:: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
Supplier:: Biorbyt
Buffer:: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Format:: Liquid or Lyophilized powder
Sequence:: VPHLGDREKRDSVCPQGKYIHPQNNSICCTKCHKGTYLYNDCPGPGQDTDCRECESGSFTASENHLRHCLSCSKCRKEMGQVEISSCTVDRDTVCGCRKNQYRHYWSENLFQCFNCSLCLNGTVHLSCQEKQNTVCTCHAGFFLRENECVSCSNCKKSLECTKLCLPQIENVKGTEDSGT

Shipping Conditions:: Blue Ice