Human CCL22 protein

Cannot supply to this region.

SKU:: ORB245259
Additional Names:: A 152E5.1 protein, ABCD 1 protein, C C motif chemokine 22 protein, CC chemokine STCP 1 protein, CC chemokine STCP-1 protein, ccl 22 protein, Ccl22 protein, CCL22_HUMAN protein, Chemokine (C C motif) ligand 22 protein, DCBCK protein, Macrophage-derived chemokine protein, MDC protein, Small inducible cytokine subfamily A member 22 protein, Small-inducible cytokine A22 protein, STCP 1 protein, Stimulated T cell chemotactic protein 1 protein
Molecular Weight:: 33.7 kDa
Purity:: Greater than 90% as determined by SDS-PAGE.
Source:: E.coli
Research Area:: Immunology & Inflammation
Storage Conditions:: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
Supplier:: Biorbyt
Buffer:: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Format:: Liquid or Lyophilized powder
Sequence:: GPYGANMEDSVCCRDYVRYRLPLRVVKHFYWTSDSCPRPGVVLLTFRDKEICADPRVP