Human MIP3 beta protein

Cannot supply to this region.

SKU:: ORB244937
Additional Names:: Beta chemokine exodus 3 protein, C C motif chemokine 19 protein, CCL19 protein, CK beta 11 protein, CKb11 protein, EBI1 ligand chemokine protein, ELC protein, MIP 3 beta protein, MIP 3b protein, MIP3B protein, MIP-3-beta protein, SCYA19 protein, Small inducible cytokine A19 protein, MIP-3-beta protein, MIP3beta protein
Molecular Weight:: 35.8 kDa
Purity:: Greater than 90% as determined by SDS-PAGE.
Source:: E.coli
Research Area:: Immunology & Inflammation
Storage Conditions:: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
Supplier:: Biorbyt
Buffer:: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Format:: Liquid or Lyophilized powder
Sequence:: GTNDAEDCCLSVTQKPIPGYIVRNFHYLLIKDGCRVPAVVFTTLRGRQLCAPPDQPWVERIIQRLQRTSAKMKRRSS