ORB244307
Dog IL8 protein

Cannot supply to this region.
- SKU:
- ORB244307
- Additional Names:
- 310C protein, 9E3 protein, AMCF1 protein, CEF-4 protein, chemokine, CXC motif, ligand 8 protein, CXC chemokine ligand 8 protein, CXC chemokine ligand 8 protein, CXCL 8 protein, Emoctakin protein, GCP 1 protein, GCP-1 protein, GCP1 protein, Granulocyte chemotactic protein 1 protein, IL 8 protein, IL8/NAP1 form I protein, Inteleukin 8 protein, Interleukin8 protein, K60 protein, LECT protein, LECT protein, LYNAP protein, MDNCF protein, Monocyte derived neutrophil activating peptide protein, NAF protein, NAP 1 protein, Neutrophil activating factor protein, Neutrophil activating factor protein, Neutrophil activating peptide 1 protein, SCYB8 protein, T-cell chemotactic factor protein, TSG1 protein
- Molecular Weight:
- 36.1 kDa
- Purity:
- Greater than 90% as determined by SDS-PAGE.
- Source:
- E.coli
- Research Area:
- Epigenetics, Immunology
- Storage Conditions:
- The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
- Supplier:
- Biorbyt
- Buffer:
- If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
- Format:
- Liquid or Lyophilized powder
- Sequence:
- AVLSRVSSELRCQCIKTHSTPFHPKYIKELRVIDSGPHCENSEIIVKLFNGNEVCLDPKEKWVQKVVQIFLKKAEKQDP
- Shipping Conditions:
- Blue Ice
