Mouse Mast Cell Chymase protein

Cannot supply to this region.

SKU:: ORB244118
Additional Names:: Alpha-chymase protein, Chymase 1 protein, Chymase 1 mast cell protein, chymase 1 preproprotein transcript E protein, chymase 1 preproprotein transcript I protein, Chymase protein, Chymase, heart protein, Chymase, mast cell protein, CMA1 protein, CYH protein, CYM protein, Mast cell chymase 1 protein, Mast cell protease 3 protein, Mast cell protease 5 protein, Mast cell protease I protein, Mast cell protease III protein, Mcp-5 protein, MCP3P protein, Mcpt5 protein
Molecular Weight:: 29.2 kDa
Purity:: Greater than 90% as determined by SDS-PAGE.
Source:: E.coli
Research Area:: Epigenetics
Storage Conditions:: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
Supplier:: Biorbyt
Buffer:: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Format:: Liquid or Lyophilized powder
Sequence:: IIGGTECIPHSRPYMAYLEIVTSENYLSACSGFLIRRNFVLTAAHCAGRSITVLLGAHNKTSKEDTWQKLEVEKQFLHPKYDENLVVHDIMLLKLKEKAKLTLGVGTLPLSANFNFIPPGRMCRAVGWGRTNVNEPASDTLQEVKMRLQEPQACKHFTSFRHNSQLCVGNPKKMQNVYKGDSGGPLLCAGIAQGIASYVHRNAKPPAVFTRISHYRPWINKILRE