ORB1906261
Recombinant Human Transforming Growth Factor - alpha

Cannot supply to this region.
- SKU:
- ORB1906261
- Molecular Weight:
- Approximately 6 kDa, a single non-glycosylated polypeptide chain containing 50 amino acids.
- Purity:
- >95% by SDS-PAGE analyses.
- Source:
- Escherichia coli
- Research Area:
- Stem Cell & Developmental Biology
- Storage Conditions:
- Use a manual defrost freezer and avoid repeated freeze-thaw cycles.- 12 months from date of receipt, -20 to -70 °C as supplied.- 1 month, 2 to 8 °C under sterile conditions after reconstitution.- 3 months, -20 to -70 °C under sterile conditions after reconstitution.
- Supplier:
- Biorbyt
- Format:
- Lyophilized from 0.2 μm filtered concentrated solution in Acetonitrile and TFA.
- Sequence:
- MVVSHFNDCPDSHTQFCFHGTCRFLVQEDKPACVCHSGYVGARCEHADLLA
- Shipping Conditions:
- Blue Ice
