ORB1882059
Recombinant Human Serine/threonine-protein kinase receptor R3 (ACVRL1), partial (Active)
Cannot supply to this region.
- SKU:
- ORB1882059
- Additional Names:
- ACVRLK1;ALK1;
- Molecular Weight:
- 11.5 kDa
- Purity:
- Greater than 95% as determined by SDS-PAGE.
- Source:
- Baculovirus
- Research Area:
- Pharmacology & Drug Discovery
- Storage Conditions:
- The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
- Supplier:
- Biorbyt
- Buffer:
- Lyophilized from a 0.2 μm filtered 20 mM Tris-HCl, 0.5 M NaCl, 6% Trehalose, pH 8.0
- Format:
- Lyophilized powder
- Sequence:
- DPVKPSRGPLVTCTCESPHCKGPTCRGAWCTVVLVREEGRHPQEHRGCGNLHRELCRGRPTEFVNHYCCDSHLCNHNVSLVLEATQPPSEQPGTDGQ
- Shipping Conditions:
- Blue Ice