Recombinant Human rhinovirus 1A Genome polyprotein, partial

Cannot supply to this region.

SKU:: ORB1882007
Additional Names:: (VP4-VP2)(P1A)(Virion protein 4)(P1B)(Virion protein 2)(P1C)(Virion protein 3)(P1D)(Virion protein 1)(P2A)(Picornain 2A)(Protein 2A)(P2B)(P2C)(P3A)(VPg)(Protein 3B)(P3B)(Picornain 3C)(P3C)(RdRp)(3D polymerase)(3Dpol)(Protein 3D)(3D)
Molecular Weight:: 45.5 kDa
Purity:: Greater than 85% as determined by SDS-PAGE.
Source:: E.coli
Storage Conditions:: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Supplier:: Biorbyt
Buffer:: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Format:: Liquid or Lyophilized powder
Sequence:: NPVENYIDEVLNEVLVVPNIKESHHTTSNSAPLLDAAETGHTSNVQPEDAIETRYVITSQTRDEMSIESFLGRSGCVHISRIKVDYTDYNGQDINFTKWKITLQEMAQIRRKFELFTYVRFDSEITLVPCIAGRGDDIGHIVMQYMYVPPGAPIPSKRNDFSWQSGTNMSIFWQHGQPFPRFSLPFLSIASAYYMFYDGYDGDNTSSKYGSVVTNDMGTICSRIVTEKQKHSVVITTHIYHKAKHTKAWCPRPPRAVPYTHSHVTNYMPETGDVTTAIVRRNTITTA