Recombinant Human Interleukin-6 (IL6) Protein (Active)

Cannot supply to this region.

SKU:: ORB1881858
Additional Names:: Interleukin-6; IL-6; B-cell stimulatory factor 2 (BSF-2); CTL differentiation factor (CDF); Hybridoma growth factor; Interferon beta-2 (IFN-beta-2); IL6 ; IFNB2
Molecular Weight:: 22.8 kDa
Purity:: Greater than 95% as determined by SDS-PAGE
Source:: Yeast
Research Area:: Immunology & Inflammation
Storage Conditions:: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Supplier:: Biorbyt
Buffer:: Lyophilized from a 0.2 μm filtered PBS, 6% Trehalose, pH 7.4
Format:: Lyophilized powder
Sequence:: VPPGEDSKDVAAPHRQPLTSSERIDKQIRYILDGISALRKETCNKSNMCESSKEALAENNLNLPKMAEKDGCFQSGFNEETCLVKIITGLLEFEVYLEYLQNRFESSEEQARAVQMSTKVLIQFLQKKAKNLDAITTPDPTTNASLLTKLQAQNQWLQDMTTHLILRSFKEFLQSSLRALRQM