Recombinant Human Insulin-like growth factor-binding protein 7 (IGFBP7) (Active)

Cannot supply to this region.

SKU:: ORB1785331
Additional Names:: Insulin-like growth factor-binding protein 7; IBP-7; IGF-binding protein 7;IGFBP-7; IGFBP-rP1; MAC25 protein; PGI2-stimulating factor; Prostacyclin-stimulating factor; Tumor-derived adhesion factor (TAF); IGFBP7;MAC25, PSF
Molecular Weight:: 55.4 kDa
Purity:: Greater than 95% as determined by SDS-PAGE.
Source:: Mammalian cell
Research Area:: Metabolism Research; Stem Cell & Developmental Biology
Storage Conditions:: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Supplier:: Biorbyt
Buffer:: Lyophilized from a 0.2 μm filtered PBS, 6% Trehalose, pH 7.4
Format:: Lyophilized powder
Sequence:: SSSDTCGPCEPASCPPLPPLGCLLGETRDACGCCPMCARGEGEPCGGGGAGRGYCAPGMECVKSRKRRKGKAGAAAGGPGVSGVCVCKSRYPVCGSDGTTYPSGCQLRAASQRAESRGEKAITQVSKGTCEQGPSIVTPPKDIWNVTGAQVYLSCEVIGIPTPVLIWNKVKRGHYGVQRTELLPGDRDNLAIQTRGGPEKHEVTGWVLVSPLSKEDAGEYECHASNSQGQASASAKITVVDALHEIPVKKGEGAEL