ORB1785323
Recombinant Human Placenta growth factor (PGF) (Active)
Cannot supply to this region.
- SKU:
- ORB1785323
- Additional Names:
- Placenta growth factor; PlGF; PGF; PGFL, PLGF
- Molecular Weight:
- 45.1 kDa
- Purity:
- Greater than 90% as determined by SDS-PAGE.
- Source:
- Mammalian cell
- Research Area:
- Stem Cell & Developmental Biology
- Storage Conditions:
- The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
- Supplier:
- Biorbyt
- Buffer:
- Lyophilized from a 0.2 μm sterile filtered PBS, 6% Trehalose, pH 7.4
- Format:
- Lyophilized powder
- Sequence:
- LPAVPPQQWALSAGNGSSEVEVVPFQEVWGRSYCRALERLVDVVSEYPSEVEHMFSPSCVSLLRCTGCCGDENLHCVPVETANVTMQLLKIRSGDRPSYVELTFSQHVRCECRPLREKMKPERRRPKGRGKRRREKQRPTDCHLCGDAVPRR
- Shipping Conditions:
- Blue Ice