ORB1785094
Recombinant Mouse Lymphocyte antigen 6 complex locus protein G6d (Ly6g6d) (Active)
Cannot supply to this region.
- SKU:
- ORB1785094
- Additional Names:
- Ng25
- Molecular Weight:
- 11.1 kDa
- Purity:
- Greater than 95% as determined by SDS-PAGE.
- Source:
- Yeast
- Research Area:
- Immunology & Inflammation
- Storage Conditions:
- The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
- Supplier:
- Biorbyt
- Buffer:
- Lyophilized from a 0.2 μm filtered 20 mM Tris-HCl,0.5 M NaCl,250mM Imidazole 6% Trehalose, pH 8.0
- Format:
- Lyophilized powder
- Sequence:
- HRTRCYDCGGGPSNSCKQTVITCGEGERCGFLDRKPQPSSEQAKQPSATLSHHYPACVATHHCNQVAIESVGDVTFTTQKNCCFGDLCN
- Shipping Conditions:
- Blue Ice