Recombinant Human Reduced folate transporter (SLC19A1), partial

Cannot supply to this region.

SKU:: ORB1674843
Additional Names:: (FOLT)(Cyclic dinucleotide:anion antiporter SLC19A1)(Folate:anion antiporter SLC19A1)(Intestinal folate carrier 1)(IFC-1)(Placental folate transporter)(Reduced folate carrier protein)(RFC)(hRFC)(Reduced folate transporter 1)(RFT-1)(Solute carrier family 19 member 1)(hSLC19A1)
Molecular Weight:: 25.5 kDa
Purity:: Greater than 85% as determined by SDS-PAGE.
Source:: E.coli
Storage Conditions:: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
Supplier:: Biorbyt
Buffer:: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Format:: Liquid or Lyophilized powder
Sequence:: DVRGLGLPVRKQFQLYSVYFLILSIIYFLGAMLDGLRHCQRGHHPRQPPAQGLRSAAEEKAAQALSVQDKGLGGLQPAQSPPLSPEDSLGAVGPASLEQRQSDPYLAQAPAPQAAEFLSPVTTPSPCTLCSAQASGPEAADETCPQLAVHPPGVSKLGLQCLPSDGVQNVNQ