ORB1096602
Recombinant Human Serine/threonine-protein phosphatase 2A catalytic subunit beta isoform (PPP2CB)
Cannot supply to this region.
- SKU:
- ORB1096602
- Additional Names:
- PP2A beta, PP2A-beta, PP2AB_HUMAN, PP2Abeta, PP2CB, Ppp2cb, Protein phosphatase 2 (formerly 2A), catalytic subunit, beta isoform, Protein phosphatase 2 catalytic subunit beta isozyme, Protein phosphatase 2, catalytic subunit, beta isoform, Protein phosphatase 2A catalytic subunit beta isoform, Protein phosphatase type 2A catalytic subunit, Serine/threonine protein phosphatase 2A catalytic subunit beta, Serine/threonine-protein phosphatase 2A catalytic subunit beta isoform
- Molecular Weight:
- 62.6 kDa
- Purity:
- Greater than 90% as determined by SDS-PAGE.
- Source:
- E.coli
- Research Area:
- Pharmacology & Drug Discovery
- Storage Conditions:
- The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
- Supplier:
- Biorbyt
- Buffer:
- If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
- Format:
- Liquid or Lyophilized powder
- Sequence:
- MDDKAFTKELDQWVEQLNECKQLNENQVRTLCEKAKEILTKESNVQEVRCPVTVCGDVHGQFHDLMELFRIGGKSPDTNYLFMGDYVDRGYYSVETVTLLVALKVRYPERITILRGNHESRQITQVYGFYDECLRKYGNANVWKYFTDLFDYLPLTALVDGQIFCLHGGLSPSIDTLDHIRALDRLQEVPHEGPMCDLLWSDPDDRGGWGISPRGAGYTFGQDISETFNHANGLTLVSRAHQLVMEGYNWCHDRNVVTIFSAPNYCYRCGNQAAIMELDDTLKYSFLQFDPAPRRGEPHVTRRTPDYFL
- Shipping Conditions:
- Blue Ice