Recombinant Human Cyclin-dependent kinase 5 activator 1 (CDK5R1), partial

Cannot supply to this region.

SKU:: ORB1095995
Additional Names:: Cyclin-dependent kinase 5 activator 1(CDK5 activator 1)(Cyclin-dependent kinase 5 regulatory subunit 1)(TPKII regulatory subunit) [Cleaved into, Cyclin-dependent kinase 5 activator 1, p35(p35), Cyclin-dependent kinase 5 activator 1, p25(p25)(Tau protein kinase II 23 kDa subunit)(p23)]
Molecular Weight:: 27.3 kDa
Purity:: Greater than 85% as determined by SDS-PAGE.
Source:: E.coli
Research Area:: Signal Transduction
Storage Conditions:: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
Supplier:: Biorbyt
Buffer:: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Format:: Liquid or Lyophilized powder
Sequence:: AQPPPAQPPAPPASQLSGSQTGGSSSVKKAPHPAVTSAGTPKRVIVQASTSELLRCLGEFLCRRCYRLKHLSPTDPVLWLRSVDRSLLLQGWQDQGFITPANVVFLYMLCRDVISSEVGSDHELQAVLLTCLYLSYSYMGNEISYPLKPFLVESCKEAFWDRCLSVINLMSSKMLQINADPHYFTQVFSDLKNESGQEDKKRLLLGLDR