Recombinant Rat Progonadoliberin-1 (Gnrh1)

Cannot supply to this region.

SKU:: ORB1095977
Additional Names:: Progonadoliberin-1(Progonadoliberin I) [Cleaved into, Gonadoliberin-1(Gonadoliberin I)(Gonadotropin-releasing hormone I)(GnRH-I)(Luliberin I)(Luteinizing hormone-releasing hormone I)(LH-RH I), Prolactin release-inhibiting factor 1(Prolactin release-inhibiting factor I)]
Molecular Weight:: 12.2 kDa
Purity:: Greater than 90% as determined by SDS-PAGE.
Source:: E.coli
Research Area:: Stem Cell & Developmental Biology
Storage Conditions:: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
Supplier:: Biorbyt
Buffer:: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Format:: Liquid or Lyophilized powder
Sequence:: QHWSYGLRPGGKRNTEHLVDSFQEMGKEEDQMAEPQNFECTVHWPRSPLRDLRGALERLIEEEAGQKKM