V2100-05
Varicella Zoster Virus, Glycoprotein E, Recombinant, aa48-135, GST-Tag (gpl, gE, VZV, gp90-58, Varicella Zoster, Chicken Pox)
Size
£460.00
- SKU:
- V2100-05
- Purity:
- ≥90% by SDS-PAGE and Bradford.
- Storage Conditions:
- -20°C
- Supplier:
- United States Biological
- Format:
- Supplied as a liquid in 50mM Tris-HCl, 60mM sodium chloride, pH 8.0, 0.25% Sarkosil, 10mM glutathione, 50% glycerol.
- Extra Details:
- Recombinant protein corresponding to aa48-135 from Varicella Zoster Virus, gE immunodominant region fused to GST-Tag at M-terminal, expressed in E. coli. Amino Acid Sequence: MITNPVRASVLRYDDFHTDEDKLDTNSVYEPYYHSDHAESSWVNRGESSR KAYDHNSPYIWPRNDYDGFLENAHEHHGVYNQGRGIDSGERLMQPTQMSAQEDLGDDTGIHVIPTLNGDDRHKIVNVDQRQYGDVFKGDLNPKPQGQRLIEVSVEENHPFTLRAPIQRIYGVRYTETWSFLPSLTCTGDAAPAIQHICLKHTTCFQDVVVDVDCAENTKEDQLAEISYRFQGKKEADQPWIVVNTSTLFDELELDPPEIEPGVLKVLRTEKQYLGVYIWNMRGSDGTSTYATFLVTWKGDEKTRNPTPAVTPQPRGAEFHMWNYHSHVFSVGDTFSLAMHLQYKIHEAPFDLLLEWLYVPIDPTCQPMRLYSTCLYHPNAPQCLSHMNSGCTFTSPHLAQRVASTVYQNCEHADNYTAYCLGISHMEPSFGLILHDGGTTLKFVDTPESLSGLYVFVVYFNGHVEAVAYTVVSTVDHFVNAIEERGFPPTAGQPPATTKPKEITPVNPGTSPLLRYAAHHHHHH Applications: Suitable for use in ELISA and Western Blot. Other applications not tested. Strongly reacts with human VZV positive serum. Recommended Dilutions: Optimal dilutions to be determined by the researcher. Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for 6 months after receipt at -20°C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
- Shipping Conditions:
- Blue Ice